Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death (By similarity). Plays an important role during the formation of the nexine layer of the pollen wall (PubMed:25336567).

Belongs to the classical AGP family.

150 amino acids

MARQFVVLVLLTLTIATAFAADAPSASPKKSPSPTAAPTKAPTATTKAPSAPTKAPAAAPKSSSASSPKASSPAAEGPVPEDDYSASSPSDSAEAPTVSSPPAPTPDSTSAADGPSDGPTAESPKSGAVTTAKFSVVGTVATVGFFFFSF

14.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AGP6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here