Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.

Belongs to the classical AGP family.

136 amino acids

MARLFVVVALLALAVGTVFAADAPSAAPTASPTKSPTKAPAAAPKSSAAAPKASSPVAEEPTPEDDYSAASPSDSAEAPTVSSPPAPTPEADGPSSDGPSSDGPAAAESPKSGATTNVKLSIAGTVAAAGFFIFSL

13 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AGP11 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here