Involved in the degradation of phenanthrene. Catalyzes the oxidation of cis-phenanthrene dihydrodiol (PDD) to yield phenanthrenediol. It can use either NAD or NADP as electron acceptor, however NAD is preferred to NADP.

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

277 amino acids

MAWLEGQSVFLTGGVAGLGRALVKRLVEEGANVTVLDRNARGLDELVESFKGRVAGSPGDVRNLADNRKAVELAVERFGKLDTFNRQRRHLGLLCPPCRPAGRCHQRSFDEVIGINLMGYVMGIKAAAPALVRSRGSVILTLSSSAFYAGGGGVLYTVAKHAAVGLIKQAAHELAPYVRVNGVAPGGIASDLRGPKSLGMGEQSITSVPLADLVKDIAPIGRLSDTEEYTGSYVYLASARNSAPATGVIINCDGGMGVRSVLGPASGGKGLLEKFGG

28.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make phnB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here