Potential effector of the planar cell polarity signaling pathway. Plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. Involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia. More generally involved in exocytosis in secretory cells.

Belongs to the small GTPase superfamily. Rab family.

249 amino acids

MSVTPVLDPEWQRSPEGLDYLSRVLRHNKRKFFGLIERPVLPPHLPADVAAYKVFVCGKSGVGKTSFIAKLSGLAVPSMHHETAGIQTTCMYWPVRPSGSARPVIFRFQFWDCGEGALRKFDHILPACKEKADAVLFLFSFTDRSSFEDVPALISRTLDQDEDVTRVVIGTKLDQYMHTDVTEDDLRDFQRTWQLPVMRVRSVNGPRMTDGRDLDGRAGLAECAPVLNGLAEILWHRDQVIAGLVGGAE

27.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cplane2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here