Protein expression services for csm-3 | Chromosome segregation in meiosis protein 3
Description
Forms a fork protection complex (FPC) with tof-1 and which is required for chromosome segregation during meiosis and DNA damage repair. FPC coordinates leading and lagging strand synthesis and moves with the replication fork. FPC stabilizes replication forks in a configuration that is recognized by replication checkpoint sensors (By similarity).
Family
Belongs to the CSM3 family.
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Length
409 amino acids
Sequence
MPAQDNDNNTSAFVNEFLAGWDDDDPFRSPSPETAGTNKTNNKKRKEPDTLGIDKEIDVTKKARVPRVKLDDARLLSDKGIPKLRKTASKLKLKGKGHEFSDAARLLSFYQEWLDDLFPKATFVDALAMCEKAGHKTTLRNARLKWIAEGKPRSTTAEEEEDRDREGQPSASAEPTRMAPIFEKATGAKSKTPTLDNNLFGDDDIYNATPRRNQPTAAPGDIPDDDELDALMAEAESGAAPGASKATNNGAASDSIFGGGAINRRPRPSEVPDDDDLDALMAEAESYRPSTTNHGSIFGNGSASGGGKDKPAMAAPPQEDDDDLDALMAEAEMHASLATKTTGKESTSRERTSEQDGGKDAQNYDEDDLDAWMAEAEAYTKTTSIQVAQPKDTDDDWEAEAAMAEMHGF
Mass
44.3 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make csm-3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here