Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of chromosome segregation and cytokinesis during mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation. In the complex, it may be required to direct the Aurora B/air-2 to centromeric DNA.

Belongs to the borealin family. Highly divergent.

249 amino acids

MPPRKIKKDPAVVAMADTLETRVKDLLEEYKKKLREVALQTAKAESDRIIATIKPKYRDMPIMEFLASPPDDFYIESGEEEEEGEAAVAVKQELPSEPDMEIDDAAAAQKTSIPIGQNSGRNTVQVKQEPEIDDDAAHETSIPIAPSGQNSGRNTAADEHRRNEIITPAGQVLPLPTLQPEKPFRAPHVDEEIAFSVNGSPLVLAGRTTATAAGKENRKKSKKSGAASKKAAAAAGPLQPETENAGTSV

26.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make csc-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here