Plays an important role in the initiation and regulation of chromosomal replication. Binds to the origin of replication; it binds specifically double-stranded DNA at a 9 bp consensus (dnaA box): 5'-TTATC[CA]A[CA]A-3'. DnaA binds to ATP and to acidic phospholipids.

Belongs to the DnaA family.

451 amino acids

MNAHPKEIWEQCLNIIKGETTEVSFNTWIKSITPISIENDTFMLTVPNDLTKGILSNKYTDLIIRSLQMVTSQKYNVKFLISSELPEEFLTLDTINEQNIKGSIIVSDEMSAMLNPKYTFTSFVIGNSNRFAHAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHHILHNNTSCKVVYVSSEKFTNELINSIKDDKNVEFRSKYRNIDVLLIDDIQFIAGKERTQEEFFHTFNALYEANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDFETRMAILKKKADVEKLNIPNEVMAYIATKIKSNIRELEGALIRIVAFSSLTNKEISVDLAIEALKDIISSGQSKQVTIELIQDVVSNYYNLKVSDFKSSRRTRNVAFPRQIAMYLCRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISNNLKKDESLKNAVNDLTKRLDQQ

51.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dnaA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here