About Products Protein Database Contact

Protein expression services for dnaA | Chromosomal replication initiator protein DnaA

Description
Plays an important role in the initiation and regulation of chromosomal replication. Binds to the origin of replication; it binds specifically double-stranded DNA at a 9 bp consensus (dnaA box): 5'-TTATC[CA]A[CA]A-3'. DnaA binds to ATP and to acidic phospholipids (By similarity).
Family
Belongs to the DnaA family.
Species
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Length
466 amino acids
Sequence
MSQEIWADVLAYVRKNVSDLEYTTWFAPVKPLGVQEGSLLLGVRNSFTKDWFRDHYLELLLAALRSLGAEHPQVEFQVLPAAQDALLLPNDPPPAPEAAAPTPKTKAAPTPPPSTPGDNRKTLNPKYTFENFVVGPNNNLAHAAALAVAESPGKAYNPLFIYGDVGLGKTHLMHAVGHYLAERFPEKRIEYVSTETFTNELINAIRDDKTTQFRNRYRSVDLLLVDDIQFLAGKERTQEEFFHTFNALYESNKQIILSSDRPPKDIQTLEGRLRSRFEWGLITDIQSPEYETRVAILKMNAEQGHITIPQEVLELIARQVTSNIRELEGALMRVVAFASLNNVPFSRAAAAKALSNVFAPQEAKVEMTDVLRQVAAHYGTTPDLIRGSGRARDIVVPRQVAQYLIRALTDHSLPEIGQFFGRDHSTVMHAVSKITEQMGKDPELAATVNTLRNRIQGKEEEEEVGA
Mass
52 kDa
Simulated SDS-PAGE
Western blot of dnaA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make dnaA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here