Chromatin remodeling factor that binds to methylated histone (e.g. H3K4me2/3) to prevent their acetylation (e.g. H3K9K14Ac), likely by recruiting histone deacetylase (HDAC) complexes, and thus regulating the transcription of target genes (PubMed:25281686). Negative regulator in developmental processes in a gibberellic acid- (GA-) dependent manner, such as germination, flowering induction, and flower organ specification, probably by modulating developmental gene expression (PubMed:11340178, PubMed:25281686). Involved in the chromatin-mediated repression of floral initiation and controls genes regulating flowering (PubMed:25281686). Negatively regulates the expression of the floral integrator FT epigenetically, by preventing high levels of H3 acetylation, thus maintaining an inactive chromatin conformation at FT locus (PubMed:25281686, PubMed:12837946).

Belongs to the SHL1/EBS protein family.

234 amino acids

MAKTRPGVASKIKTGRKELDSYTIKGTNKVVRAGDCVLMRPSDAGKPPYVARVEKIEADARNNVKVHCRWYYRPEESLGGRRQFHGAKELFLSDHFDVQSAHTIEGKCIVHTFKNYTRLENVGAEDYYCRFEYKAATGAFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCAECSSDDDVKKSQNGFTSSPADDVKVRLSLFSHLLYRCSITYL

26.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EBS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here