Component of the chromatin assembly factor complex (CAF-1) involved in chromatin assembly following DNA replication and DNA repair. Required for several aspects of development, including seedling growth and leaf hair differentiation. Plays a critical role in the organization of shoot apical meristem (SAM) and root apical meristem (RAM) during postembryonic development by facilitating stable maintenance of gene expression states. Seems not required to maintain transcriptional repression of heterochromatic genes. Involved in heterologous recombination.

Belongs to the WD repeat HIR1 family.

487 amino acids

MKGGTIQISWHDGKPVLTVDFHPISGLLATAGADYDIKLWLINSGQAEKKVPSVSYQSSLTYHGCAVNTIRFSPSGELLASGADGGELFIWKLHPSETNQSWKVHKSLSFHRKDVLDLQWSPDDAYLISGSVDNSCIIWDVNKGSVHQILDAHCHYVQGVAWDPLAKYVASLSSDRTCRIYANKPQTKSKGVEKMNYVCQHVIMKADQQRGDETKTIKTHLFHDETLPSFFRRLSWSPDGSFLLIPAGSFKVSPTSEAVNATYVFSRKDLSRPALQLPGASKPVVVVRFCPVAFKLRGSSSEEGFFKLPYRLVFAIATLNSVYIYDTECVAPIAVLAGLHYAAITDITWSPNASYLALSSQDGYCTLVEFEDKELGEAVSISVGKKPVDGEEKKHDLEKGDELMTETTPDESKKQAELEQNEESKQPLPSKITTDGKEKEHIMQKTDDEVMTETRHEEENQPLQSKVNTPVSNKPARKRITPMAIDP

54.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FAS2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here