Removes the pyruvyl group from chorismate to provide 4-hydroxybenzoate (4HB). Involved in the synthesis of glycosylated p-hydroxybenzoic acid methyl esters (p-HBADs) and phenolic glycolipids (PGL) that play important roles in the pathogenesis of mycobacterial infections (By similarity).

Belongs to the chorismate pyruvate-lyase type 2 family.

210 amino acids

MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLLDVAPKIPELENLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPIGEIMAASRIETYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYFLRSVFQDTPREELDRCQYSNDIDTRSGDRFVLHGRVFKNL

24 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ML0133 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here