About Products Protein Database Contact

Protein expression services for CSP41A | Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic

Description
Binds and cleaves RNA, particularly in stem-loops. Associates with pre-ribosomal particles in chloroplasts, and participates in chloroplast ribosomal RNA metabolism, probably during the final steps of 23S rRNA maturation. May enhance transcription by the plastid-encoded polymerase and translation in plastid via the stabilization of ribosome assembly intermediates. Required for chloroplast integrity. Involved in the regulation of the circadian system.
Family
Belongs to the NAD(P)-dependent epimerase/dehydratase family.
Species
Arabidopsis thaliana
Length
406 amino acids
Sequence
MAALSSSSLFFSSKTTSPISNLLIPPSLHRFSLPSSSSSFSSLSSSSSSSSSLLTFSLRTSRRLSPQKFTVKASSVGEKKNVLIVNTNSGGHAVIGFYFAKELLSAGHAVTILTVGDESSEKMKKPPFNRFSEIVSGGGKTVWGNPANVANVVGGETFDVVLDNNGKDLDTVRPVVDWAKSSGVKQFLFISSAGIYKSTEQPPHVEGDAVKADAGHVVVEKYLAETFGNWASFRPQYMIGSGNNKDCEEWFFDRIVRDRAVPIPGSGLQLTNISHVRDLSSMLTSAVANPEAASGNIFNCVSDRAVTLDGMAKLCAAAAGKTVEIVHYDPKAIGVDAKKAFLFRNMHFYAEPRAAKDLLGWESKTNLPEDLKERFEEYVKIGRDKKEIKFELDDKILEALKTPVAA
Mass
43.9 kDa
Simulated SDS-PAGE
Western blot of CSP41A recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CSP41A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here