Participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. Involved in assembling the dolichol-pyrophosphate-GlcNAc(2)-Man(5) intermediate on the cytoplasmic surface of the ER.

Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 33 subfamily.

447 amino acids

MTLVLLLSIFAICFSSVAFIQLLPTRREKKSSEAHDAVSVQIDTIVCLLRPPRSSSNSPTLNRVADSTPNQELLDHPLISIVALPSPPALLQTKKKFLFPVAAILKVLQQAWHLWAALGYRTGPAHWILVQNPPAAPTLALALLACHLRHSRLIIDWHNFGYSILALKLGSGHPMVKLMEWYEKAFSCYATAHFCVSNAMARILREQFEIKKPLMVLHDRPSSAFSPIFDEKQRLAILSSIPETSQSAIDIIEGRCRLLVSSTSWTPDEDFSLLLDALCRYSTSAKSSGLPSVPLLVIITGKGPLKDMYLSQIDKLKAEGKLFNVFIKTAWLSFEDYAQLLACATLGVCLHTSSSGVDLPMKVVDMFGAGLPVVGWDQYEAWPELVTEGVTGLGFDSADRLSGLLKSVLGGDGSALKVLREGAVKESRNRWDQTWDPIAGTFLGLVT

49.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ARB_01551 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here