Probable integral membrane protein required for the rotation of the flagellar motor. Might be a linker that fastens the torque-generating machinery to the cell wall.

Belongs to the MotB family.

330 amino acids

MQKQEHVVFKRAKAHGHDEPHGGAWKVAFADFMIALMALFLVLWVMQVVDKEERKAIVAHLHSSSVFDKSYGNPFDTSQSISPIDLAQDSSVPSKHNSNHVVSSYFQGDGDGPEINSLVPGTFDTQEQLAALAKVIEEMTAQINAQGNVNVTVTPQGLRIVLQDDYKQHMFSRGGAELTPFFEDLLLALAPLFEQVTNPLIISGHTDAIPFKKRFGRQSNWALSASRADVARKTLVEGGMPDDRVMQVTGMSDRALLNPDEPDSSENRRIELFILTTPAAKVLETLFGNQDDSELQKAKQKAEFNQPVIRQEVIRYSADAEKQEAKIQAL

36.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lafU using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here