Protein expression services for cheD | Chemoreceptor glutamine deamidase CheD
Description
Deamidates glutamine residues on chemoreceptors (MCPs). CheD-mediated MCP deamidation is required for productive communication of the conformational signals of the chemoreceptors to the CheA kinase. In addition, demethylates methylated glutamate residues on chemoreceptors Mcp2 and Mcp4. Enhances the activity of CheC.
Family
Belongs to the CheD family.
Species
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Length
157 amino acids
Sequence
MKKVIGIGEYAVMKNPGVIVTLGLGSCVAVCMRDPVAKVGAMAHVMLPDSGGKTDKPGKYADTAVKTLVEELKKMGAKVERLEAKIAGGASMFESKGMNIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEYNIETGKLLVRKVGGGEQLEIKEI
Mass
16.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make cheD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here