Deamidates glutamine residues to glutamate on methyl-accepting chemotaxis receptors (MCPs). CheD-mediated MCP deamidation is required for productive communication of the conformational signals of the chemoreceptors to the CheA kinase (By similarity).

Belongs to the CheD family.

159 amino acids

MTKGETISIGEWKVVKGEGVLRTCGLGSCIGIVLYDQERVIAGMVHVMLPDSTKARKGANPWRYADTAIASLQAELKKQGARKLCAKMAGGAQMFKHAVKREFMQIGERNAAAARETLARLGITLVAEDIGGTKGRTIQYDVKTGELAVRTVHHGQMIL

17.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cheD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here