Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Involved in late stages of cytokinesis. Plays a role in endosomal sorting/trafficking of EGF receptor (By similarity).

Belongs to the SNF7 family.

220 amino acids

MGLFGKTQERPPKDLVNEWSLKIRKEMRVIDRQIRDIQREQEKVKRSIKESAKKGNREACVILAKEVVQSKKAVNKLYASKAHMNSVLMSMKNQLAVLRVSGSLQKSTEVMKAMQNLVKLPEIQATMRELSKEMMKAGIIEEMLEDTFEGMEDQDEMEEQAEMEIDRILFEVTAGALGKAPSKVTDALPEPEITGAMAASDEEEEEDLEAMHSRLAALRS

24.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make chmp3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here