About Products Protein Database Contact

Protein expression services for chmp2a | Charged multivesicular body protein 2a

Description
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids (By similarity).
Family
Belongs to the SNF7 family.
Species
Danio rerio
Length
220 amino acids
Sequence
MESLFGRRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFERQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLSDELSNLPATGGSLSVAAGKKAEPQPTLADADADLEERLNNLRRD
Mass
25.1 kDa
Simulated SDS-PAGE
Western blot of chmp2a recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make chmp2a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here