Chaperone that may play a role in mitochondrial protein folding. Involved in female gametophyte development. Required for cell death of the synergid cells during fertilization process, and fusion of the polar nuclei during megagametogenesis.

Belongs to the DnaJ family.

456 amino acids

MVPSNGAKVLRLLSRRCLSSSLIQDLANQKLRGVCIGSYRRLNTSVGNHANVIGDYASKSGHDRKWINFGGFNTNFGSTRSFHGTGSSFMSAKDYYSVLGVSKNAQEGEIKKAYYGLAKKLHPDMNKDDPEAETKFQEVSKAYEILKDKEKRDLYDQVGHEAFEQNASGGFPNDQGFGGGGGGGFNPFDIFGSFNGDIFNMYRQDIGGQDVKVLLDLSFMEAVQGCSKTVTFQTEMACNTCGGQGVPPGTKREKCKACNGSGMTSLRRGMLSIQTTCQKCGGAGQTFSSICKSCRGARVVRGQKSVKVTIDPGVDNSDTLKVARVGGADPEGDQPGDLYVTLKVREDPVFRREGSDIHVDAVLSVTQAILGGTIQVPTLTGDVVVKVRPGTQPGHKVVLRNKGIRARKSTKFGDQYVHFNVSIPANITQRQRELLEEFSKAEQGEYEQRTATGSSQ

49.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GFA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here