Mediates assembly of pili by forming soluble multimeric complexes with pili subunits as an intermediate step in the assembly process.

Belongs to the periplasmic pilus chaperone family.

single

115 amino acids

LQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVNRNYNTPYLSYINDYGGRPVLSFICNGSRCSVKKEK

13.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make prsD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here