Description
Chanoclavine-I aldehyde reductase; part of the gene cluster that mediates the biosynthesis of isofumigaclavines, fungal ergot alkaloids (PubMed:28620689). The tryptophan dimethylallyltransferase ifgA catalyzes the first step of ergot alkaloid biosynthesis by condensing dimethylallyl diphosphate (DMAP) and tryptophan to form 4-dimethylallyl-L-tryptophan (PubMed:28620689). The second step is catalyzed by the methyltransferase ifgB that methylates 4-dimethylallyl-L-tryptophan in the presence of S-adenosyl-L-methionine, resulting in the formation of N-methyl-dimethylallyl-L-tryptophan (PubMed:28620689). The catalase ifgD and the FAD-dependent oxidoreductase ifgC then transform N-methyl-dimethylallyl-L-tryptophan to chanoclavine-I which is further oxidized by ifgE in the presence of NAD(+), resulting in the formation of chanoclavine-I aldehyde (PubMed:28902217). The chanoclavine-I aldehyde reductases ifgG and/or fgaOx3 reduce chanoclavine-I aldehyde to dihydrochanoclavine-I aldehyde that spontaneously dehydrates to form 6,8-dimethyl-6,7-didehydroergoline (PubMed:28620689, PubMed:28902217). The festuclavine dehydrogenases ifgF1 and/or ifgF2 then catalyze the reduction of 6,8-dimethyl-6,7-didehydroergoline to form festuclavine (PubMed:28620689). Hydrolysis of festuclavine by a yet undetermined cytochrome P450 monooxygenase (called ifgH) then leads to the formation of isofumigaclavine B which is in turn acetylated by ifgI to isofumigaclavine A (PubMed:28620689). Penicillium roqueforti has interestingly at least two sets of genes for the consumption of chanoclavine-I aldehyde on three different loci, the OYEs ifgG/fgaOx3 and the festuclavine synthase homologs ifgF1/ifgF2 (PubMed:28620689, PubMed:28902217). The reason for the duplication of these genes is unclear, probably to ensure the conversion of chanoclavine-I aldehyde by differential gene expression under various environmental conditions (PubMed:28902217).
Family
Belongs to the NADH:flavin oxidoreductase/NADH oxidase family.
Species
Penicillium roqueforti (strain FM164)
Sequence
MTIIPKHPSPTLFKPLALGKCQLQHRIVMSPTTRYRADEAAVPLPFVKEYYAQRASDPGALLITEATNICPNSVGEAHIPGIWSKTQCEAWREVVSQVHAKECYIFCQIYATGRSADPELLASRGFEQVSSSAVAAEPGCQPPRALDEEEIQKYISDYAQAARNAIEVGFDGVEIHGANGYLIDQFTQASCNQRTDEWGGDIPNRARFALQVTMAVINAIGPDRVGMKLSPWSQYSGMGIMGDLVPQFEYLILQLRQLGIAYLHLANSRWLDQMTTHPDPNHLTFVKVWGRSLPVILAGGYDATSAPEVIEMVYADYDNVAIGFGRYFTSTPDLPFRMKNGIALQKYDRSSFYTCLTKTGYLDYPYSPEYLCRSS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service