Involved in ceramide synthesis. In vitro, isoform 3 stimulates the production of C16-, C18- and C20-ceramides, isoform 1 slightly increases the levels of C18- and C20-ceramides, while isoform 2 exhibits only minimal activity. May interfere with adipogenesis by stimulating ceramide synthesis.

275 amino acids

MLTPMVAGGVVFPGLFLLSKNTLQRLPQLRWEEADAVIVSARLVSSVQAIMASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGEDGTPRALGSTWAVVRGYLHKEFLMVLHHAAMVLVCFPLSVVWRQGKGDFFLGCMLMAEVSTPFVCLGKILIQYKQQHTLLHKVNGALMLLSFLCCRVLLFPYLYWAYGRHAGLPLLSVPMAIPAHVNLGAALLLAPQLYWFFLICRGACRLFRPRGSPPPSPCQTQD

30.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Fam57b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here