May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner.

350 amino acids

MAAAAATPRLEAPEPMPSYAQMLQRSWASALAAAQGCGDCGWGLARRGLAEHAHLAAPELLLAVLCALGWTALRWAATTHIFRPLAKRCRLQPRDAARLPESAWKLLFYLACWSYCAYLLLGTSYPFFHDPPSVFYDWRSGMAVPWDIAVAYLLQGSFYCHSIYATVYMDSWRKDSVVMLVHHVVTLLLIASSYAFRYHNVGLLVFFLHDVSDVQLEFTKLNIYFKARGGAYHRLHGLVANLGCLSFCFCWFWFRLYWFPLKVLYATCHCSLQSVPDIPYYFFFNILLLLLMVMNIYWFLYIVAFAAKVLTGQMRELEDLREYDTLEAQTAKPCKAEKPLRNGLVKDKLF

40.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Cers1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here