Catalyzes the reversible phosphorolysis of cellobionic acid (4-O-beta-D-glucopyranosyl-D-gluconate), a probable step in cellulose degradation. May be part of a metabolic pathway where cellobionic acid is converted into alpha-D-glucose 1-phosphate and D-gluconic acid to enter glycolysis and the pentose phosphate pathway, respectively. Produces 4-O-beta-D-glucopyranosyl-D-glucuronate from alpha-D-glucose 1-phosphate and D-glucuronate with low activity in the synthetic direction.

Belongs to the glycosyl hydrolase 94 family. Cellobionic acid phosphorylase subfamily.

791 amino acids

MTRKMPTLVRPTHNGERYEITNPTAMPKAAGFLWNQKMMIQITCRGFATAQFMQPEPAKYAYAPNIEAKTFMQPEPNYYAHHPGRFVYIKDEETGRLFSAPYEPVRAPHDRFVFSAGKTDVFWVIESMGIRVEMTMGLPTHHVAELWTIKVKNLSSRPRKLSVTPYFPIGYMSWMNQSAEWNHNLNGIVASCVTPYQKAADYFKNKYLKDKTYFLCDVPPDSWEASQQAFEGEGGLHNPSALQERNLSGSDARYETPTAAVQYKIALGTGEQQEYRFLFGPAHDEAEIGAMRSKYLSKEGFEQTAADYAAYMARGRGCLHVETPDKDLDNFINNWLPRQVYYHGDVNRLTTDPQTRNYLQDNMGMNYIKPEVSRRAFLTAIAQQEATGAMPDGILLVEGAELKYINQVPHTDHCVWLPVTLEAYLNETGDYSLLKEKVPSANGDKLTVFERFCRAMDWLLKSRDHRGLSYIAQGDWCDPMNMVGYKGKGVSGWLTLATAFSLNIWAKVCDHEGETDLAKRFREGADACNAAANEHLWDGEWFARGITDDNVVFGIKEDKEGRIWLNPQSWSILSGAASPEQIDKMLPQIDSHLNTPYGIQMFGPPYTKMREDVGRVTQKAIGSAENAAVYNHAGIFFIHSLYELGAQQDRAFTLLRQMLPGPTDTDYIQRGQLPIYIPNYYRGAWKECPRTAGRSSQLFNTGTVSWVYRCIIEGLCGLRGDGEGLLIRPQLPSSWNSMKVTREFRGATFNVDIRRGNVKEVTVRNGDKVLPAPHVKDIEPGQTYNLTVTIP

89.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NCU09425 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here