Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell.

Belongs to the MinE family.

90 amino acids

MLDIINRLLGRENAGSRDIARERLRLVLIHDRASVSPNFLNALKEELIRVIREYMEIDEESLIVDLENEENSVALVANIPIRGFKRAANE

10.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make minE2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here