About Products Protein Database Contact

Protein expression services for zapB | Cell division protein ZapB

Description
Non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA.
Family
Belongs to the ZapB family.
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Length
79 amino acids
Sequence
MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLSQEVQEAAGGREALVRENEQLKQEQHVWQDRLRALLGKMEEV
Mass
9.3 kDa
Simulated SDS-PAGE
Western blot of zapB recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make zapB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here