Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.

Belongs to the FtsZ family.

408 amino acids

MLEKLLEQAGIKLDFDGEEEKKSEIVDEFSGYKINIAVVGVGGSGNNTISRLYDLGVQGADLIAMNTDAQHLAITKAHKKVLLGKHITQGKGSGGDPKVGYLAAEASAQEIAAAVDGYDLVFITAGMGNGTGTGAAPVVARIVKETARNNGRFQEPLVVSVVTFPFKTEGTVRIEKAKWGIQRLLEYSDTVIIIQNDKLLELVPKLPLQSAFRFADELIARMVKGIVETIKLNSIVNIDFADVYSIMKGGGPALIGIGESDSNNRAVDAVNNALTNKMLDVEFGSGEKALVHFTIGPDVSLEEINKAMEVVYEKLSEKSEIKWGAMVDPEMGKTVRAMVIMTGVRSPYILGNVNALTDSSSWVVPKDRRLIGDPRIEKMFPDFNGSRAGRKRPSVGDAILKELGFKEL

44.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ftsZ2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here