Part of the ABC transporter FtsEX involved in asymmetric cellular division facilitating the initiation of sporulation. May act as an importer, possibly at the top of a hierarchical cascade leading to the correct temporal initiation of sporulation. Acts upstream of the histidine kinases KinA, KinB and KinC, the RapA phosphatase and the Spo0A sporulation protein.

Belongs to the ABC-4 integral membrane protein family. FtsX subfamily.

296 amino acids

MIKILGRHLRESFKSLGRNTWMTFASISAVTVTLILVGVFLVIMLNLNNMATNAEKQVEIKVLIDLTADQKAQDKLQNDIKELKGIQSVTFSSKEKELDQLVDSFGDSGKSLTMKDQENPLNDAFVVKTTDPHDTPNVAKKIEKMDHVYKVTYGKEEVSRLFKVVGVSRNIGIALIIGLVFTAMFLISNTIKITIFARRKEIEIMKLVGATNWFIRWPFFLEGLLLGVFGSVIPIALVLSTYQYVIGWVVPKVQGSFVSLLPYNPFVFQVSLVLIAIGAVIGVWGSLTSIRKFLRV

33.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ftsX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here