Cell division protein that is required for growth during stress conditions. May be involved in protecting or stabilizing the divisomal assembly under conditions of stress.

Belongs to the FtsP family.

469 amino acids

MPRLSRRQLLKTAAISTALSTVPAPLLAASREKLVVPPLIEVRRGRPIVLTMQETNYPLDGSHNVTVWGFNGNYLGPTIKIKSGSFAKLNYHNNLPQSVALSIQGLQASGELFGGAARVLKKGESWAPIVPIEQPAASCWYRSATLANSAYQTYRGLAGMWLIEDEQSLKANLPNKYGVDDIPLILQDMEFNNDGLQLFKQNQPHFVGNRLLVNGIEAPYLDVARGWIRLRLLNASLARAYDLRLDNDQEMLLIAQDLSFLPKAKSVKSLVLSPGERAEILVNMNEIDNVSLISGSKRSLYEKIKNMLFSGDELANNTVLELRAQGQLSAFNKQPNLTFETDAPAILQQAVAQTREFNIDVTNGLINQRRFDPRKVDVMARKGTIERWILNASLPVGFTIQGAKFVVESQGEHQLQAEELAWKDTVWVKNKTQILVKFDQASSGNFPFLFGVSNLMLEDMGCLGVLMVQ

52.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ftsP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here