About Products Protein Database Contact

Protein expression services for sulA | Cell division inhibitor SulA

Description
Component of the SOS system and an inhibitor of cell division. Accumulation of SulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. In the presence of GTP, binds a polymerization-competent form of FtsZ in a 1:1 ratio, thus inhibiting FtsZ polymerization and therefore preventing it from participating in the assembly of the Z ring. This mechanism prevents the premature segregation of damaged DNA to daughter cells during cell division (By similarity).
Family
Belongs to the SulA family.
Species
Edwardsiella tarda (strain FL6-60)
Length
168 amino acids
Sequence
MRTSPLHPATDSVVFSRPACQSAPTVPQSGFVSELGYGAQQPLLSLLLPPLLRQLGEQSRWQLWITAQHKPSKRWLSACGVPVHKVMQLRRAEAGEAIYAMEQALRSGNYSVVLGWLPPLTAAERLRLNRAAQAGRSIGLLMQPQEGKLAAAAPPQAHAANRGSARYH
Mass
18.3 kDa
Simulated SDS-PAGE
Western blot of sulA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make sulA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here