About Products Protein Database Contact

Protein expression services for Tmem30a | Cell cycle control protein 50A

Description
Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. The beta subunit may assist in binding of the phospholipid substrate. Required for the proper folding, assembly and ER to Golgi exit of the ATP8A2:TMEM30A flippase complex. ATP8A2:TMEM30A may be involved in regulation of neurite outgrowth, and, reconstituted to liposomes, predomiminantly transports phosphatidylserine (PS) and to a lesser extent phosphatidylethanolamine (PE). The ATP8A1:TMEM30A flippase complex seems to play a role in regulation of cell migration probably involving flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. Required for the formation of the ATP8A2, ATP8B1 and ATP8B2 P-type ATPAse intermediate phosphoenzymes. Involved in uptake of platelet-activating factor (PAF). Can also mediate the export of alpha subunits ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B and ATP11C from ER to other membrane localizations (By similarity).
Family
Belongs to the CDC50/LEM3 family.
Species
Rattus norvegicus
Length
328 amino acids
Sequence
MAMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKFRNPPGKDSLQEKFKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLYRLIERTDDLHPTLPAGQYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTADITI
Mass
37.2 kDa
Simulated SDS-PAGE
Western blot of Tmem30a recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Tmem30a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here