May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can regulate their activity. Thought to have a role in the uptake of lipids and proteins in the intestinal cells; operates in the apical uptake of lipid markers and trafficking of yolk proteins. Affects fecundity and egg laying.

Belongs to the caveolin family.

351 amino acids

MTRQNTSESDNTQRPPIPQYDTVDDIDELTDAMDKEDHHHHHHHHEHHHQHQGIAQYDTVEEVETLETVHHRTSLNQEVPTPQRRSHPQYDNLDDIDDQEYITEVEVKSNRGSTLTTRPHVTIKQDEIEDIGERQVTVIEIASQKGSTKRVAPRKDYAPSIPLPEHPAQQSAPPTQQSRPQTTSHKPPNPEMEFDIGVKNIAPVLIHKMNMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLHTSRGEQVVEVWEKHIHHV

40.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cav-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here