Effector of the programmed cell death (PCD) activators rpr, grim and hid (PubMed:9740659). May play an apoptotic role in the germline as well as soma. Fadd interacts with Dredd to promote cleavage of Dredd and is necessary and sufficient for enhancing Dredd-induced apoptosis (PubMed:10934188). Plays a role in the innate immune response. Required for resistance to Gram-negative bacterial infection (PubMed:11269502). Diap2-mediated ubiquitination of Dredd is critical for processing of imd and rel and the subsequent expression of antimicrobial genes such as DptA (PubMed:22549468).

Belongs to the peptidase C14A family.

494 amino acids

MAGSNLLIHLDTIDQNDLIYVERDMNFAQKVGLCFLLYGDDHSDATYILQKLLAMTRSDFPQSDLLIKFAKSRPETWRRHLVEALCIIGARKVLRRLGFCWQELRMHYLPHIAGITLHVHPLLKSLYRMCEELSLVQSGRLLLDVREKVESQQAGDPLRFYDPAYLEIFLLDWLTRRSIKLGDINAAGSDVQLLVGHLKSNGLQAQANLLKDTIISNAPEPDAAGTAAMAVKQEIESDNQQSYCSTQIDALKLTRENAGIALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRGSNDESMVPNVKSTFRQHVYFPPRL

56.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Dredd using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here