Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion (By similarity).

Belongs to the Casparian strip membrane proteins (CASP) family.

186 amino acids

MKAGALELGEGSKTSIPRGGVNRGISILDFILRLITIIGTLGSAIAMGTTNETLPFFTQFTQFRAEYDDLPTFTFFVIANSIVSGYLVLSLPMSILHIVRSGARASRIVLIFFDTAMLALLTAAASAASAIVYLAHKGNAQANWFAICQQFKSFCERISGSLIGSFGGIILFILLVLLSAVALSRC

19.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make VIT_14s0108g01050 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here