Protein expression services for cak1-1 | Casein kinase I
Description
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Can phosphorylate a large number of proteins. May have a role in DNA repair mechanism and support vegetative growth of the cells.
Family
Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.
Species
Dictyostelium discoideum
Length
426 amino acids
Sequence
MDLRIGGKYRISRKIGGGSFGEIYLGTNISTNEEVAIKLEPAKAIHPQLLFESKLYKIFQGGIGIPAVKWFGFDGDYNIMVMDLLGPSLEDLFNYCGRKFSLKTVLMLGDQMLRRIEFIHSNNFIHRDIKPDNFLMGIGKRGHVVNLIDFGLAKRYRDPKTHQHIPYREHKNLTGTARYASLNTHQGIEQSRRDDLESLGYVLMYFNRGSLPWQGLKAYTKRDKYEKICDKKAQTKIDTLCQGFPSEFATFLNYTRFLKFEDKPDFLYLRKLLREMFVREGYRYDYMFDWVIVRKLREKPPLERPLSNDNKQIQQQIQQQQQAQQQLQQQAQQQQQQTTTTTTTSSSQPSNVKNISTVSNIATTTTDEQFRQLLSTPSYNNVDSDQSPQQTTTTTSSSNPNQTTFYRQNKVVVPQSSSTTTKPPAK
Mass
49.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make cak1-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here