Involved in the detoxification of xenobiotics. Shows maximal activity with C6 substrates, with gradually decreasing activity from C8 to C12 substrates. No activity for higher chain length substrates acids rather than long-chain ones (By similarity).

Belongs to the lipase/esterase LIP3/BchO family.

246 amino acids

MKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPEELVHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHIKSEEVMYQGVLSYARNYKKFEGKSPEQIEEEMKEFEKTPMNTLKALQDLIADVRNNVDMIYSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEFLEKLDW

28.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make est using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here