Catalyzes the reversible hydration of CO(2) to H(2)CO(3). The main role may be to provide inorganic carbon for the bicarbonate-dependent carboxylation reactions catalyzed by pyruvate carboxylase, acetyl-CoA carboxylase and carbamoyl-phosphate synthetase (By similarity). Involved in osmoadaptation.

Belongs to the beta-class carbonic anhydrase family.

228 amino acids

MPDPSDRKAVTRYLEQTHDKIFESNRAWVASKKGADPEFFNKLAAGQSPEYLYIGCSDSRVPANEIMGLDAGEVFVHRNIANVVPTIDLSSMSVINYAVGHLKVKHIVVCGHYNCGGVQAALTPTDLGILNPWLRNIRDVYRLHEKELDAIEDDGERFNRLVELNVIESCRSVIKTAVVQQSYEENGFPIVHGWVFNLKDGLLKDLNIDFPGILADIQKIYNLTKGSS

25.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AN1805 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here