May be involved in the formation of the carboxysome, a polyhedral inclusion where RuBisCO is sequestered.

Belongs to the bacterial microcompartments protein family.

103 amino acids

MANETMGIALGMIETRGLVPAIEAADAMTKAAEVRLIGREFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARPHREVEPALGNGNFLGQKD

10.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ccmK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here