Sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units.

Belongs to the sulfotransferase 1 family.

multiple

159 amino acids

SGTTDFYRRIITSEASASTLSLENFXHRVTESINMYEKCFKNETMRKCVYDRSLSLLSGVRLRIGLYWIYLQDWFSVFPKENFYIIKTEDYAKCLKCTFKKVYRFLGLPQLNRTNEAFMESIPKANTRRFKDTKMGKMWKETYELLEKFYQPHNERLVK

19.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GALNAC4S6ST using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here