Probably catalyzes the deacetylation of acetylated carbohydrates an important step in the degradation of oligosaccharides.

Belongs to the YdjC deacetylase family.

237 amino acids

MKLIVNADDFGLSRGVNYGIVDAHELGIVTSTTMLTNMPATNHAFQLMEKYPKLKVGVHLTLSCGAPITTDCPTLINPQGEFRLTSQYLLLKEHGLSEEEVEAEWEAQIQQFYKRGVTPSHLDSHHHIHTWEPIIPVIKRLAQKYDLPVRTGFRNPPNGVRLWSDVIDAGFYGEGVKEKYFIELYEKFKAYDGTIEIMCHPAYIDEVLRQHSSYVEGRLKEFEMLTRIKLAEDVTLI

27.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BH0913 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here