Acts as an inhibitor of cap-dependent translation. Competes with eIF4G1 and EAP1 for binding to eIF4E and interferes with the formation of the eIF4F complex, inhibiting translation and stabilizing mRNA (By similarity).

Belongs to the CAF20 family.

171 amino acids

MAKYTEEQLYEIKEEAYTPQPDVLDAFNKMVDHVKEHAAAEFEKHKNLKWSNGDTYIDENGNERPYHHMNKRRGSRSGNKPNLRKKSTDGIKVDDDGWATLTKPKKSFGAEDGVEERNKFRESVKDIKVKPNNKNLGSSKAVDPRDAIAEKHTNTFNAFEALGDGDDSDDE

19.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CAF20 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here