Secreted aspartic peptidases (SAPs) are a group of ten acidic hydrolases considered as key virulence factors. These enzymes supply the fungus with nutrient amino acids as well as are able to degrade the selected host's proteins involved in the immune defense.

Belongs to the peptidase A1 family.

588 amino acids

MQRVLELLLLSSTALAVIGDGFIALPVHKLQAGEGSAHFPNRLPIFDVVNGVAKSVEDDVNQIIQPIFGNGIFSGGSIQGTHSGNGHSVKYEVSLPSSSSQKGSNGPSSTDNKDTDPSKTGFSLDDLMNSIPTDFWNLIGLNKAPTSSDNGSKDADFTPSAVSQVEQPTSKSVESTAPGPASSASSSSSSEAASSSQPSEDSQPSSSANKKTGAFFLSLDNTQTLYTATLKVGSPAQEVQVMIDTGSSDLWFISSGNSQCKVNGGSIDCDKYGVFDKSKSSTWHDNKTDYSISYYDGDKASGTMGQDNITFADGFSIENANFAVIDNTTSSIGVFGVGYPELEAVKSKYTNLPFAMKEQNLIAKVAYSLYLDSRDAVQGYILFGGIDHAKYTGDLKAFDIVQSNDKYVYSQIPLTSVASSLNNYTNAYGLPAGSNHPKVGAVIYNGTDSFNGGVDLKDTPTLLDTGTTYSYLSKDQVESIVGLYGNVTYNDAGKAYEVPCWVGNPGNYLEFNFKNEQYIKVPTSEFVISVGTYASGAELCVFGILPGTHSILGDNFMRSVYAVFDLEDHVISIAQAAYNDNHAVVPIE

62.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SAP7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here