Calcium-binding protein involved in larval development and metamorphosis. Likely to function as calcium buffers mediating the transport of calcium from the sea water to the blastocoel where calcium is required for skeleton formation.

141 amino acids

MAANLLFSEDQIKEYKTKFDAFDRNNDGNFPTMFLGNAMKSVGHVLTAAELENSRRVRKGTTTFPQFLAMILDKKCRKVFKAMDKDDKDKLLSADEVRQAMLSFDRQITEDKIKEMIEKADFPNDGKCSLEEFVKMVMNFC

16.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SPEC2D using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here