About Products Protein Database Contact

Protein expression services for Kcnmb4 | Calcium-activated potassium channel subunit beta-4

Description
Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. May decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. Makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations (By similarity).
Family
Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB4 subfamily.
Species
Rattus norvegicus
Length
210 amino acids
Sequence
MAKLRVSYEYTEAEDKSIRLGLFLIVSGILSLFIFGFCWLSPALQDLQATAANCTVLSVQQIGEVFECTFTCGTDCRGTSQYPCVQVYVNNSESNSRALLHSDQHQLLTNPKCSYIPPCKRENQKNSESVMNWQQYWKDEIGSQPFTCYFNQHQRPEDVLLQRTHDEIVLLHCFLWPVVAFVVGVLIVVLTICAKSLAVKAEAMKKRKFS
Mass
23.9 kDa
Simulated SDS-PAGE
Western blot of Kcnmb4 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Kcnmb4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here