Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate (By similarity).

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

191 amino acids

MGKKLVMAQRRGETRALCLGVAMVVGAVITYYILGTTVLPLYQKSVWTQESTCHLIETNIRDQEELEGKRVPQYPCLWVNVSSVGRWAVLYHTEDTRDQNHQCSYIPSSLDNYQVARADVEKVRARFHENQDFFCFSTTRENETSVLYRRLYGPQSLLFSLFWPTFLLTGGLLIIVMVKINQSLSILAAQR

22 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make KCNMB1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here