Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria. Constitutes a pore-forming and calcium-conducting subunit. Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways.

Belongs to the MCU (TC 1.A.77) family.

293 amino acids

MWSVMGLVRRTAMSSTVNKASPVRSLLGGFRCLNVESKEEDEKKDMTVLEAKKLMRLVNVEDMKKKLIGMGDKEMVTYTTLIEASQGLGIARSLDEAHAFARVLDDAGVILIFRDKVYLHPHKVVDLIRKAVPLGLNPDDELIREEFDKMRSMKEEIDVLAHQQVRKILWGGLGYSVVQIGIFVRLTFWEFSWDVMEPITFFTTATGIIVGYAYFLMTSRDPTYQDFMKRLFLSRQRKLLKSHKFDAERFKELENKWKITSCSSSSCHANASIRNRVGVDLDLEDSLQSHHRD

33.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make At1g57610 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here