CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.

Belongs to the calcitonin family.

134 amino acids

MDFWKFFPFLALSSMWVLCLASSLQAAPFRSALESSLDLGTLSDQEKHLLLAALIQDYEQKARKLEQEEQETEGSRKGSSSSVISQKRSCNTATCVTHRLAGLLRRSGGVVKDNFVPTNVGSKAFGRRRRDLRV

15 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Calcb using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here