Esterase involved in the biosynthesis of lignin. Hydrolyzes caffeoylshikimate into caffeate and shikimate. Together with 4-coumarate--CoA ligase (4CL), acts on an alternative reaction for the formation of caffeoyl-CoA and bypasses the second reaction of shikimate O-hydroxycinnamoyltransferase (HST). Accepts also 4-coumaroylshikimate as substrate, but with lower activity. According to PubMed:20345607 and PubMed:22915575, posseses monoacylglycerol O-acyltransferase, monoacylglycerol lipase and lysophospholipase activities in vitro. With the association of ACBP2, may promote the degradation of lysophosphatidylcholine and detoxify the peroxidized membrane in response to cadmium-induced oxidative stress. However these results require additional confirmation in vivo.

Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.

332 amino acids

MPSEAESSANSAPATPPPPPNFWGTMPEEEYYTSQGVRNSKSYFETPNGKLFTQSFLPLDGEIKGTVYMSHGYGSDTSWMFQKICMSFSSWGYAVFAADLLGHGRSDGIRCYMGDMEKVAATSLAFFKHVRCSDPYKDLPAFLFGESMGGLVTLLMYFQSEPETWTGLMFSAPLFVIPEDMKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPQRYTGKPRVGTMRELLRKTQYVQENFGKVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKTLKIYEGMYHSLIQGEPDENAEIVLKDMREWIDEKVKKYGSKTA

37 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CSE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here