Catalyzes the hydrolitical oxidation of 1,3,7-trimethylxanthine (caffeine) by incorporation of an oxygen atom originating from a water molecule into position C-8 to produce 1,3,7-trimethyluric acid (TMU). Coenzyme Q0 is the preferred electron acceptor and coenzyme Q2 can also be used, but oxygen and NADP cannot.

167 amino acids

MSSHVISLTVNGQAIERKVDSRTLLADFLRDELRLTGTHVGCEHGVCGACTIQFDGEPARSCLMLAVQAEGHSIRTVEALAVDGCLGALQQAFHEKHGLQCGFCTPGLLMTLDYALTADLHIDFSSDKEIRELISGNLCRCTGYQNIINAIKSVSPTTEIAKSEELV

18 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cdhC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here