Global transcriptional regulator that complexes with cAMP and binds to specific DNA promoter sites, causing DNA-bending, to regulate transcription. cAMP improves binding to specific DNA sequences, probably by altering protein conformation. Involved in the regulation of gntP and gntK genes, which are involved in gluconate metabolism (PubMed:16385030). May form dimers which bind to the aceB promoter region in the presence of cAMP and repress the glyoxylate bypass genes (PubMed:15150232). It could be a positive regulator of rpf2 gene expression during growth on acetate as the sole carbon source, however because the cytosolic cAMP level is elevated in the presence of glucose and low upon growth on acetate, it is conceivable that it is unable to function as an activator under acetate conditions (PubMed:18355281).

227 amino acids

MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR

25 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make glxR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here